TBC1D25 Monoclonal antibody, PBS Only

• 

  WB analysis using 67574-1-Ig (same clone as 67574-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67574-1-Ig (TBC1D25 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67574-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67574-1-Ig (same clone as 67574-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67574-1-Ig (TBC1D25 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67574-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 67574-1-Ig (same clone as 67574-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using TBC1D25 antibody (67574-1-Ig, Clone: 2C7H3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67574-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 67574-1-Ig (same clone as 67574-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using TBC1D25 antibody (67574-1-Ig, Clone: 2C7H3 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 67574-1-PBS in a different storage buffer formulation.

TBC1D25 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67574-1-PBS

Clone No.2C7H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

2C7H3, TBC1 domain family member 25, TBC1 domain family, member 25

---

Product Information

67574-1-PBS targets TBC1D25 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29470

  Product name: Recombinant human TBC1D25 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 32-299 aa of BC101817

  Sequence: EREVVRVRVKKCESFLPPEFRSFAVDPQITSLDVLQHILIRAFDLSGKKNFGISYLGRDRLGQEVYLSLLSDWDLSTAFATASKPYLQLRVDIRPSEDSPLLEDWDIISPKDVIGSDVLLAEKRSSLTTAALPFTQSILTQVGRTLSKVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRANPEDLEFIRSTVLKDVLRTDRAH

• Full Name: TBC1 domain family, member 25
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC101817
• Gene Symbol: TBC1D25
• Gene ID (NCBI): 4943
• RRID: AB_2882787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q3MII6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.