TBC1D8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TBC1D8 Polyclonal antibody (33583-1-AP)

• 

  WB analysis using 33583-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33583-1-AP (TBC1D8 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 33583-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 33583-1-AP (TBC1D8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TBC1D8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33583-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

AD 3, TBC1 domain family member 8, Vascular Rab-GAP/TBC-containing protein, VRP

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33583-1-AP targets TBC1D8 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35398

  Product name: Recombinant human TBC1D8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 941-1140 aa of NM_001102426

  Sequence: RNPLLSTSRPLVFGKPNGDAVDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATVTTLLLQIGEVGQRGSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSELKLSNL

• Full Name: TBC1 domain family, member 8 (with GRAM domain)
• Calculated Molecular Weight: 130kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_001102426
• Gene Symbol: TBC1D8
• Gene ID (NCBI): 11138
• RRID: AB_3743021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95759
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The TBC1D8 protein is a member of the TBC domain family and functions as a GTPase-activating protein (GAP) that negatively regulates the activity of small G proteins of the Rab family, participating in the fine-tuning of intracellular vesicle transport and signal transduction. This protein has garnered significant attention in reproductive and cancer research. Studies have shown that TBC1D8 is a key determinant of oocyte maturation and female fertility, with defects in its expression leading to embryonic development arrest. Moreover, TBC1D8 is abnormally overexpressed in various cancers (such as breast and lung cancer), where it acts as an oncogene by modulating signaling pathways related to cell proliferation, invasion, and metastasis (e.g., the EGFR/Ras pathway). Thus, it serves as a potential biomarker for disease diagnosis and a therapeutic target.