TBK1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TBK1 Polyclonal antibody (28397-1-AP)

• Featured Product
• KD/KO Validated

TBK1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28397-1-AP

Publications(143)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

EC:2.7.11.1, NF kappa B activating kinase, NF-kappa-B-activating kinase, Serine/threonine protein kinase TBK1, Serine/threonine-protein kinase TBK1

• 

  WB analysis using 28397-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28397-1-AP (TBK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 28397-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28397-1-AP (TBK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 28397-1-AP

  WB result of TBK1 antibody (28397-1-AP; 1:4000; room temperature for 1.5 hours) with wild-type and TBK1 knockout HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of U2OS using 28397-1-AP

  U2OS lysates prepared and IP of TBK1 performed using 1.0 μg of 28397-1-AP coupled to protein A- Sepharose beads. The Ponceau stained transfers of each blot are shown. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IHC staining of human liver cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 28397-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using TBK1 antibody (28397-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 28397-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TBK1 antibody (28397-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HCT 116 cells, HeLa cells, HepG2 cells, U2OS cells
• Positive IHC detected in: human stomach cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28397-1-AP targets TBK1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28894

  Product name: Recombinant human TBK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 316-576 aa of BC034950

  Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA

• Full Name: TANK-binding kinase 1
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC034950
• Gene Symbol: TBK1
• Gene ID (NCBI): 29110
• RRID: AB_2881132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHD2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Adv; Inhibition of ACLY overcomes cancer immunotherapy resistance via polyunsaturated fatty acids peroxidation and cGAS-STING activation; Authors - Wei Xiang
mouse,human	WB	Mol Ther; STING/ACSL4 axis-dependent ferroptosis and inflammation promote hypertension-associated chronic kidney disease; Authors - Li Gao
human	WB	Protein Cell; Dephosphorylation of cGAS by PPP6C impairs its substrate binding activity and innate antiviral response.; Authors - Mi Li
bovine	WB	J Anim Sci Biotechnol; β-Hydroxybutyrate-induced mitochondrial DNA (mtDNA) release mediated innate inflammatory response in bovine mammary epithelial cells by inhibiting autophagy; Authors - Yihui Huo
human	WB	PLoS Pathog; SARS-CoV-2 spike-induced syncytia are senescent and contribute to exacerbated heart failure; Authors - Huilong Li
human	WB	PLoS Pathog; TRIM32 inhibits Venezuelan equine encephalitis virus infection by targeting a late step in viral entry; Authors - Yifan Xie