TBK1 Polyclonal antibody

• 

  WB analysis using 28397-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28397-1-AP (TBK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28397-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28397-1-AP (TBK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 28397-1-AP

  WB result of TBK1 antibody (28397-1-AP; 1:4000; room temperature for 1.5 hours) with wild-type and TBK1 knockout HeLa cells.

• 

  IP experiment of U2OS using 28397-1-AP

  U2OS lysates prepared and IP of TBK1 performed using 1.0 μg of 28397-1-AP coupled to protein A- Sepharose beads. The Ponceau stained transfers of each blot are shown. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IHC staining of human liver cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 28397-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28397-1-AP (TBK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 28397-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using TBK1 antibody (28397-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 28397-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TBK1 antibody (28397-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

TBK1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28397-1-AP

Publications(79)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:2.7.11.1, NF kappa B activating kinase, NF-kappa-B-activating kinase, Serine/threonine protein kinase TBK1, Serine/threonine-protein kinase TBK1

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HCT 116 cells, HeLa cells, HepG2 cells, U2OS cells
• Positive IHC detected in: human stomach cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 78 publications below
• IHC: See 3 publications below
• IP: See 2 publications below

Product Information

28397-1-AP targets TBK1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28894

  Product name: Recombinant human TBK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 316-576 aa of BC034950

  Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA

• Full Name: TANK-binding kinase 1
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC034950
• Gene Symbol: TBK1
• Gene ID (NCBI): 29110
• RRID: AB_2881132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHD2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Adv; Inhibition of ACLY overcomes cancer immunotherapy resistance via polyunsaturated fatty acids peroxidation and cGAS-STING activation; Authors - Wei Xiang
mouse,human	WB	Mol Ther; STING/ACSL4 axis-dependent ferroptosis and inflammation promote hypertension-associated chronic kidney disease; Authors - Li Gao
human	WB	Protein Cell; Dephosphorylation of cGAS by PPP6C impairs its substrate binding activity and innate antiviral response.; Authors - Mi Li
bovine	WB	J Anim Sci Biotechnol; β-Hydroxybutyrate-induced mitochondrial DNA (mtDNA) release mediated innate inflammatory response in bovine mammary epithelial cells by inhibiting autophagy; Authors - Yihui Huo
human	WB	PLoS Pathog; SARS-CoV-2 spike-induced syncytia are senescent and contribute to exacerbated heart failure; Authors - Huilong Li
human	WB	PLoS Pathog; TRIM32 inhibits Venezuelan equine encephalitis virus infection by targeting a late step in viral entry; Authors - Yifan Xie