TBKBP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TBKBP1 Polyclonal antibody, PBS Only (32915-1-PBS)

• 

  WB analysis using 32915-1-AP (same clone as 32915-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32915-1-AP (TBKBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32915-1-PBS in a different storage buffer formulation.

TBKBP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32915-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

KIAA0775, SINTBAD, TANK-binding kinase 1-binding protein 1, TBK1-binding protein 1

---

Product Information

32915-1-PBS targets TBKBP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38233

  Product name: Recombinant human TBKBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-350 aa of NM_014726.2

  Sequence: LQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSP

• Full Name: TBK1 binding protein 1
• Calculated Molecular Weight: 68kDa，615aa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: NM_014726.2
• Gene Symbol: TBKBP1
• Gene ID (NCBI): 9755
• RRID: AB_3742785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A7MCY6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.