Product Information
32915-1-PBS targets TBKBP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38233 Product name: Recombinant human TBKBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-350 aa of NM_014726.2 Sequence: LQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSP Predict reactive species |
| Full Name | TBK1 binding protein 1 |
| Calculated Molecular Weight | 68kDa,615aa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | NM_014726.2 |
| Gene Symbol | TBKBP1 |
| Gene ID (NCBI) | 9755 |
| RRID | AB_3742785 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | A7MCY6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TBKBP1 encodes TANK-binding kinase 1-binding protein 1, an adaptor protein that binds TBK1 and participates in the TNF/NF-κB pathway. It is also positioned in biological programs associated with innate immune response, defense response to virus, and type I interferon-mediated signaling.

