TBX15 Polyclonal antibody, PBS Only

TBX15 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 25148-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

25148-1-PBS targets TBX15 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18423

Product name: Recombinant human TBX15 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 227-496 aa of BC122553

Sequence: DFTTMQKQQGGSTGTSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVHMV

Predict reactive species
Full Name T-box 15
Calculated Molecular Weight 602 aa, 66 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC122553
Gene Symbol TBX15
Gene ID (NCBI) 6913
RRIDAB_2879924
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96SF7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TBX15 is a transcription factor from the T-box family and is a highly pleiotropic gene expressed in multiple tissues at different stages of development. It is required for skeletal development and deletions in this gene cause severe skeletal malformation. In addition, TBX15 also plays a role in the differentiation of brown and beige adipocytes (PMID: 28007980). The predicted molecular weight of TBX15 is 66 kDa. With modification, the MW of TBX15 will be migrated to 50 kDa.

Loading...
||
New chat Able
正在加载,请稍候...