TBX18 Polyclonal antibody

TBX18 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 23237-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

T box 18, T box protein 18, TBX18

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, human placenta tissue, mouse kidney tissue, rat kidney tissue
Positive IHC detected inhuman kidney tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23237-1-AP targets TBX18 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19258

Product name: Recombinant human TBX18 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 350-532 aa of BC157841

Sequence: PSLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGY

Predict reactive species
Full Name T-box 18
Calculated Molecular Weight 607 aa, 65 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC157841
Gene Symbol TBX18
Gene ID (NCBI) 9096
RRIDAB_2879237
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDO95935
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The T-box (Tbx) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The Tbx gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. Tbx genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in Tbx genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of Tbx products has come mainly from the prototypical T/Brachyury, which is a transcription activator. The Tbx genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.This antibody specifically reacts with the 65kd TBX18 protein.

Protocols

Product Specific Protocols
IHC protocol for TBX18 antibody 23237-1-APDownload protocol
WB protocol for TBX18 antibody 23237-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

EBioMedicine

E2A ablation enhances proportion of nodal-like cardiomyocytes in cardiac-specific differentiation of human embryonic stem cells.

Authors - Xiuya Li
ratWB

Mol Med Rep

G9a inhibition promotes the formation of pacemaker-like cells by reducing the enrichment of H3K9me2 in the HCN4 promoter region

Authors - Pei Xu
Loading...
||
New chat Able
正在加载,请稍候...