TCEAL7 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TCEAL7 Recombinant monoclonal antibody, PBS Only (87945-1-PBS)

• 

  WB analysis using 87945-1-RR (same clone as 87945-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87945-1-RR (TCEAL7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87945-1-PBS in a different storage buffer formulation.

TCEAL7 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87945-1-PBS

Clone No.253550E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MPMGp800C04260Q003, TCEA like protein 7, TCEA-like protein 7, Transcription elongation factor A protein-like 7, Transcription elongation factor S-II protein-like 7

---

Product Information

87945-1-PBS targets TCEAL7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5177

  Product name: Recombinant human TCEAL7 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-mFc

  Tag: C-mFc

  Domain: 1-100 aa of BC016786

  Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

• Full Name: transcription elongation factor A (SII)-like 7
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC016786
• Gene Symbol: TCEAL7
• Gene ID (NCBI): 56849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BRU2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCEAL7 is a transcription regulatory factor that has a role in the negative regulation of NF-kappa-B signaling at the basal level by regulating transcriptional activity of NF-kappa-B on its target gene promoters. It can associate with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. In addition, TCEAL7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines. This antibody can detect a band around 12 kDa, which corresponds to the calculated molecular weight.