Product Information
87945-1-PBS targets TCEAL7 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5177 Product name: Recombinant human TCEAL7 protein Source: mammalian cells-derived, pHZ-KIsec-C-mFc Tag: C-mFc Domain: 1-100 aa of BC016786 Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI Predict reactive species |
| Full Name | transcription elongation factor A (SII)-like 7 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC016786 |
| Gene Symbol | TCEAL7 |
| Gene ID (NCBI) | 56849 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BRU2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TCEAL7 is a transcription regulatory factor that has a role in the negative regulation of NF-kappa-B signaling at the basal level by regulating transcriptional activity of NF-kappa-B on its target gene promoters. It can associate with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. In addition, TCEAL7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines. This antibody can detect a band around 12 kDa, which corresponds to the calculated molecular weight.

