TCF20 Polyclonal antibody

• 

  WB analysis using 32030-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32030-1-AP (TCF20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TCF20 Polyclonal Antibody for WB, ELISA

Cat No. 32030-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA0292, Nuclear factor SPBP, Protein AR1, SPBP, SPRE-binding protein

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, U-251 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32030-1-AP targets TCF20 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36912

  Product name: Recombinant human TCF20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 480-650 aa of NM_005650

  Sequence: TPQKKTSKRPSSSKKADSCTNSEGSSQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKGGASEKAGSSPAQGAQNEPPRLNASPAAREEATSPGAKDMPLSSDGNPKVNEKTVGVIVSREAMTGRVEKPGGQDKGSQEDDPAATQRPPSNGGAKETSHA

• Full Name: transcription factor 20 (AR1)
• Calculated Molecular Weight: 1960aa, 212 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: NM_005650
• Gene Symbol: TCF20
• Gene ID (NCBI): 6942
• RRID: AB_3670174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UGU0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transcription Factor 20 (TCF20) is a transcriptional activator that binds to the regulatory region of MMP3 and thereby controls stromelysin expression. It stimulates the activity of various transcriptional activators such as JUN, SP1, PAX6 and ETS1, suggesting a function as a coactivator (PMID: 10995766). The calculated molecular weight of TCF20 is 211 kDa, but due to extensive modifications (Glycosylation, Sumoylation. Phosphorylation), the observed molecular weight is about 250 kda.