TCF3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TCF3 Polyclonal antibody (21242-1-AP)

• Featured Product
• KD/KO Validated

TCF3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 21242-1-AP Copied!

Publications (16)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF/ICC, IP, CoIP, ChIP, ELISA, CUT&RUN

Synonyms

E2A, bHLHb21, Class B basic helix-loop-helix protein 21, E47, Immunoglobulin enhancer-binding factor E12/E47

• 

  WB analysis of Jurkat using 21242-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21242-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 21242-1-AP

  WB result of TCF3 antibody (21242-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TCF3 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 21242-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 21242-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 21242-1-AP

  IP result of anti-TCF3 (IP:21242-1-AP, 4ug; Detection:21242-1-AP 1:500) with Jurkat cells lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 21242-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TCF3 antibody (21242-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TCF3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, PC-3 cells, NIH/3T3 cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21242-1-AP targets TCF3 in WB, IF/ICC, IP, CoIP, ChIP, ELISA, CUT&RUN applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15734

  Product name: Recombinant human TCF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 318-480 aa of BC110580

  Sequence: WPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQ

• Full Name: transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
• Calculated Molecular Weight: 654 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC110580
• Gene Symbol: TCF3
• Gene ID (NCBI): 6929
• RRID: AB_10755295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TCF3 Polyclonal antibody (Cat# 21242-1-AP) has 16 citations spanning journals including Nature Immunology, Nature Cell Biology, Cancer Research, Nature Communications, Cell Death Discovery, Journal of Immunotherapy of Cancer, Cell Signaling, Molecular Immunology, Life Sciences, International Journal of Molecular Sciences, Journal of Cellular and Molecular Medicine, Journal of Biomedical Research, Frontiers in Medicine, Animals, and International Journal of Oral Science. Research fields cover immunology, cancer biology (EMT, ferroptosis, AML), cell differentiation, T cell development, renal fibrosis, stem cell pluripotency, and osteogenesis.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,CUT&RUN	Nat Immunol; Mapping self-associating chromatin hubs identifies Id proteins as key determinants of exhausted CD8(+) T cell fate.; Authors - Wei Hu
mouse	IF	Nat Cell Biol; Mapping putative enhancers in mouse oocytes and early embryos reveals TCF3/12 as key folliculogenesis regulators; Authors - Bofeng Liu
human	WB	Cancer Res; TRAPPC4 Promotes GPX4 Stability to Drive Ferroptosis Resistance and Tumor Progression in Head and Neck Squamous Cell Carcinoma; Authors - Zhao Ding
mouse	WB	Nat Commun; A p38α-BLIMP1 signalling pathway is essential for plasma cell differentiation; Authors - Jianfeng Wu
human	WB	Nat Commun; DSS1 inhibits autophagy to activate epithelial-mesenchymal transition in a pro-metastatic niche of renal cell carcinoma.; Authors - Xiaoyu Chen
human	WB	J Immunother Cancer; CD146+ CAFs mediate immunosuppression in gastric cancer via COL4A1: potential therapeutic targets; Authors - Jia Chen

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating from a ChIP application. The reviewer noted that although the antibody had not yet been used, it was shipped promptly and arrived in good condition. Overall, the feedback is positive, highlighting reliable shipping and product quality upon receipt.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Emma (Verified Customer) (12-04-2025)

The antibody hasn't been used yet, but it was shipped in a timely manner and received in good condition.

• Applications: ChIP