Tested Applications
| Positive WB detected in | mouse thymus tissue |
| Positive IHC detected in | mouse spleen tissue, human lymphoma tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue, human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14464-1-AP targets TCF1/TCF7 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5792 Product name: Recombinant human TCF7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-384 aa of BC048769 Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL Predict reactive species |
| Full Name | transcription factor 7 (T-cell specific, HMG-box) |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC048769 |
| Gene Symbol | TCF1/TCF7 |
| Gene ID (NCBI) | 6932 |
| ENSEMBL Gene ID | ENSG00000081059 |
| RRID | AB_2878061 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36402 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCF7, also known as TCF1, belongs to the TCF/LEF family. TCF7 is part of the Wnt signaling pathway and plays an important role in the differentiation and self-renewal of memory T cells. It has been found that TCF7 is necessary to revive T cells in response to PD-1 blockade against viral infection or cancer. TCF7 is mainly expressed in T-cells and is also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. TCF7 has 16 isoforms with the molecular mass of 28-54 kDa (PMID: 34044317).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TCF1/TCF7 antibody 14464-1-AP | Download protocol |
| IHC protocol for TCF1/TCF7 antibody 14464-1-AP | Download protocol |
| WB protocol for TCF1/TCF7 antibody 14464-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TCF1/TCF7 Polyclonal antibody (Cat# 14464-1-AP) has 30 citations. These appear in journals including Molecular Cancer, Nature Immunology, Cell Reports, Cell Molecular Immunology, Clinical Cancer Research, Journal of Translational Medicine, International Journal of Biological Macromolecules, Clinical and Translational Medicine, Cell Proliferation, Cancer Immunology & Immunotherapy, International Journal of Molecular Sciences, Frontiers in Pharmacology, Molecular Medicine Reports, iScience, Frontiers in Bioscience, Frontiers in Medicine, Molecular Carcinogenesis, Animals, Journal of Immunotherapy, Human Cell, Neoplasma, Onco Targets and Therapy, Journal of Orthopaedic Research, Journal of Food Biochemistry, and Translational Cancer Research. Research fields span cancer biology, Wnt/β-catenin signaling, T-cell immunity, stemness, and EMT.
| Species | Application | Title |
|---|---|---|
Mol Cancer Targeting BATF2-RGS2 axis reduces T-cell exhaustion and restores anti-tumor immunity | ||
Nat Immunol The transcriptional cofactor Tle3 reciprocally controls effector and central memory CD8+ T cell fates | ||
Nat Immunol Tcf1-CTCF cooperativity shapes genomic architecture to promote CD8+ T cell homeostasis. | ||
Cell Mol Immunol TRIM27 maintains gut homeostasis by promoting intestinal stem cell self-renewal | ||
Clin Cancer Res Single-Cell Analyses Reveal Mechanisms of Cancer Stem Cell Maintenance and Epithelial-Mesenchymal Transition in Recurrent Bladder Cancer.
| ||
J Transl Med TMEM176B inhibits ovarian cancer progression by regulating EMT via the Wnt/β-catenin signaling pathway |
Reviews
What customers say
The single review for this product is highly positive, with a 5-star rating. The user tested the antibody at a 1/1000 dilution on Jurkat cells for Western Blot and reported excellent detection. They described the performance as highly recommended, indicating strong satisfaction with the antibody's specificity and signal quality in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
James (Verified Customer) (04-23-2026) | This antibody gave excellent detection in my western blot. Highly recommended
 |
