TCL1A Recombinant monoclonal antibody, PBS Only

• 

  Affinity of 85129-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 85129-1-PBS against Human TCL1A were performed. The affinity constant is 4.40 nM.

TCL1A Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85129-1-PBS

Clone No.242623D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

Oncogene TCL-1, T-cell leukemia/lymphoma protein 1A, TCL1

---

Product Information

85129-1-PBS targets TCL1A in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0786

  Product name: Recombinant human TCL1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-114 aa of BC005831

  Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

• Full Name: T-cell leukemia/lymphoma 1A
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC005831
• Gene Symbol: TCL1A
• Gene ID (NCBI): 8115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56279
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.