TCTEX1D2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TCTEX1D2 Polyclonal antibody, PBS Only (26994-1-PBS)

• 

  WB analysis using 26994-1-AP (same clone as 26994-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26994-1-AP (TCTEX1D2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26994-1-PBS in a different storage buffer formulation.

TCTEX1D2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26994-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

DYNLT2B

---

Product Information

26994-1-PBS targets TCTEX1D2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25770

  Product name: Recombinant human TCTEX1D2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC021177

  Sequence: MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEGLANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY

• Full Name: Tctex1 domain containing 2
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC021177
• Gene Symbol: TCTEX1D2
• Gene ID (NCBI): 255758
• RRID: AB_2890214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WW35
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DYNLT2B also known as TCTEX1D2, belongs to the dynein family and is required for proper retrograde ciliary transport(PMID: 29742051). TCTEX1D2 functions as a light chain that appears to stabilize the retrograde IFT dynein complex. Mutations in TCTEX1D2 are associated with Short-rib thoracic dysplasia 17 with or without polydactyly (SRTD17)( PMID: 26044572).