TCTN1 Polyclonal antibody

• 

  WB analysis using 28630-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28630-1-AP (TCTN1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28630-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 28630-1-AP (TCTN1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

TCTN1 Polyclonal Antibody for WB, ELISA

Cat No. 28630-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

FLJ21127, TCTN1, TECT1, Tectonic 1, tectonic family member 1

---

Tested Applications

• Positive WB detected in: DU 145 cells, mouse brain tissue, HCT 116 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28630-1-AP targets TCTN1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30064

  Product name: Recombinant human TCTN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 168-306 aa of BC062611

  Sequence: EVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYGVPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRKKVPITVQSIVIQSLNKTLTRREDTDV

• Full Name: tectonic family member 1
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 60-75 kDa
• GenBank Accession Number: BC062611
• Gene Symbol: TCTN1
• Gene ID (NCBI): 79600
• RRID: AB_2918185
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2MV58
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.