TDP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TDP1 Polyclonal antibody, PBS Only (10641-1-PBS)

• 

  WB analysis of MCF-7 using 10641-1-AP (same clone as 10641-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10641-1-AP (TDP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10641-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10641-1-AP (same clone as 10641-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10641-1-AP (TDP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10641-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 10641-1-AP (same clone as 10641-1-PBS)

  IP result of anti-TDP1 (IP:10641-1-AP, 4ug; Detection:10641-1-AP 1:1000) with HeLa cells lysate 1200ug. This data was developed using the same antibody clone with 10641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 10641-1-AP (same clone as 10641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10641-1-AP (TDP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 10641-1-AP (same clone as 10641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10641-1-AP (TDP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10641-1-AP (same clone as 10641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10641-1-AP (TDP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10641-1-AP (same clone as 10641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10641-1-AP (TDP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10641-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TDP1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10641-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Tyrosyl-DNA phosphodiesterase 1, Tyr-DNA phosphodiesterase 1, Tyr DNA phosphodiesterase 1, EC:3.1.4.-

---

Product Information

10641-1-PBS targets TDP1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0964

  Product name: Recombinant human TDP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-298 aa of BC006083

  Sequence: MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGTHL

• Full Name: tyrosyl-DNA phosphodiesterase 1
• Calculated Molecular Weight: 34 kDa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC006083
• Gene Symbol: TDP1
• Gene ID (NCBI): 55775
• RRID: AB_2240520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tyrosyl DNA phosphodiesterase 1 (TDP1) is an enzyme capable of hydrolyzing phosphodiester bonds between tyrosine and the 3-phosphate of DNA, which are typically generated in a transient manner by DNA topoisomerase I (topo I) and it appears to be more mobile and diffusible than topo I, and it has a different distribution in the nucleus (PMID:15494395). TDP1 is involed in protecting cells against oxidative DNA damage, and with the impaired ability of TDP1-deficient cells to remove 3-phosphoglycolate (PMID:21041670). Defects in TDP1 are the cause of spinocerebellar ataxia autosomal recessive with axonal neuropathy (SCAN1)(PMID:17948061).