Use Able AI chat for product recommendations

Tie-2/CD202b Polyclonal antibody

Tie-2/CD202b Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

TEK, Angiopoietin 1 receptor, Angiopoietin-1 receptor, CD202B, EC:2.7.10.1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Tie-2/CD202b in ?

Tested Applications

Positive WB detected inmouse lung tissue, mouse liver tissue, Rat lung tissue
Positive IP detected inmouse lung tissue
Positive IHC detected inhuman placenta tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19157-1-AP targets Tie-2/CD202b in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13523

Product name: Recombinant human TEK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 779-1124 aa of BC035514

Sequence: RRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSHHLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA

Predict reactive species
Full Name TEK tyrosine kinase, endothelial
Calculated Molecular Weight 1124 aa, 126 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC035514
Gene Symbol Tie2
Gene ID (NCBI) 7010
RRIDAB_10644297
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02763
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tie2 (also known as TEK) is a tyrosine-protein kinase expressed almost exclusively on endothelial cells. It contains two immunoglobulin-like domains, three epidermal growth factor (EGF)--like domains and three fibronectin type III repeats. Tie2 acts as a cell-surface receptor for ANGPT1, ANGPT2, and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Mutations in the gene Tie2 are associated with inherited venous malformations of the skin and mucous membranes. Human Tie2 has a calculated molecular weight of 126 kDa. As a result of glycosylation, the apparent molecular mass of Tie2 is approximately 140-160 kDa.

Protocols

Product Specific Protocols
IF protocol for Tie-2/CD202b antibody 19157-1-APDownload protocol
IHC protocol for Tie-2/CD202b antibody 19157-1-APDownload protocol
IP protocol for Tie-2/CD202b antibody 19157-1-APDownload protocol
WB protocol for Tie-2/CD202b antibody 19157-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-Tie-2/CD202b (19157-1-AP), a rabbit polyclonal antibody, has 38 citations published in journals including Experimental Hematology & Oncology, Advanced Science, Small, Cancer Letters, Journal of Translational Medicine, Stem Cell Research & Therapy, and Molecular Cancer Therapeutics. Associated research fields encompass angiogenesis, oncology (lung, breast, glioma, colorectal, renal cell carcinomas), cardiovascular disease, intervertebral disc degeneration, rheumatoid arthritis, diabetic nephropathy, cerebral ischemia, Alzheimer's disease, and reproductive disorders.

SpeciesApplicationTitle
humanWB

Exp Hematol Oncol

Fibronectin promotes tumor angiogenesis and progression of non-small-cell lung cancer by elevating WISP3 expression via FAK/MAPK/ HIF-1α axis and activating wnt signaling pathway

Authors - Fei Zhou
rat

Adv Sci (Weinh)

3-D Sustained-Release Culture Carrier Alleviates Rat Intervertebral Disc Degeneration by Targeting STING in Transplanted Skeletal Stem Cells

Authors - Liwen Luo
ratIF

Small

Hydrogel and Microgel Collaboration for Spatiotemporal Delivery of Biofactors to Awaken Nucleus Pulposus-Derived Stem Cells for Endogenous Repair of Disc

Authors - Junwu Wang
mouseWB

Cancer Lett

Electroacupuncture Facilitates Vascular Normalization by Inhibiting Glyoxalase1 in Endothelial Cells to Attenuate Glycolysis and Angiogenesis in Triple-Negative Breast Cancer

Authors - Yu-Xiang Wan

Phytomedicine

Fuhu Lijie Tang treats rheumatoid arthritis through multitarget therapy from autoantigen formation to bone destruction

Authors - Zhongliu Yao
humanWB

Mater Today Bio

Doxorubicin-loaded PEGylated liposome modified with ANGPT2-specific peptide for integrative glioma-targeted imaging and therapy

Authors - Hongyan Li
Loading...
||
New chat

Able™

正在加载,请稍候...