TEKT5 Polyclonal antibody

• 

  WB analysis using 26108-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 26108-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 26108-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 26108-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26108-1-AP (TEKT5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat testis using 26108-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 26108-1-AP (TEKT5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TEKT5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26108-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

TEKT5, tektin 5

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HepG2 cells, mouse brain tissue, NIH/3T3 cells, mouse testis tissue
• Positive IHC detected in: rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26108-1-AP targets TEKT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23295

  Product name: Recombinant human TEKT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-146 aa of BC130336

  Sequence: MEFLGTTQTASYCGPKKCCGLTSLPAVQAPVIQECYQPYYLPGYRYLNSWRPSLFYKIANVQTCPDESTSTLRPPTILPTLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLS

• Full Name: tektin 5
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC130336
• Gene Symbol: TEKT5
• Gene ID (NCBI): 146279
• RRID: AB_2880381
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96M29
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.