TELO2 Monoclonal antibody, PBS Only (Detector)

TELO2 Monoclonal Antibody for WB, IHC, IF/ICC, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 66077-1-PBS
Clone No.3H10F4

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

TEL2, Protein clk-2 homolog, Protein clk 2 homolog, KIAA0683, hCLK2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66077-1-PBS targets TELO2 as part of a matched antibody pair:

MP50016-1: 66077-2-PBS capture and 66077-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8834

Product name: Recombinant human TELO2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 488-837 aa of BC017188

Sequence: DLDSDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTSEDIERWEAALRALEGLVYRSPTATREVSVELAKVLLHLEEKTCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFYALNYSLRQRMDILDVLTLAAQELSRPGCLGRTPQPGSPSPNTPCLPEAAVSQPGSAVASDWRVVVEERIRSKTQRLSKGGPRQGPAGSPSRFNSVAGHFFFPLLQRFDRPLVTFDLLGEDQLVLGRLAHTLGALMCLAVNTTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLSLPAARLLEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPASP

Predict reactive species
Full Name TEL2, telomere maintenance 2, homolog (S. cerevisiae)
Calculated Molecular Weight 837 aa, 92 kDa
Observed Molecular Weight 92 kDa
GenBank Accession NumberBC017188
Gene Symbol TELO2
Gene ID (NCBI) 9894
RRIDAB_11182835
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y4R8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TELO2 gene encodes a telomere length regulation protein TEL2 homolog. TELO2 may be involved in telomere length regulation and can form TTT complex with TTI1 and TTI2. TTT complex is required to stabilize protein levels of PIKK family proteins and is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), and ultraviolet (UV). The activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals, can be promoted, stabilized and maintained by TELO2.

Loading...
||
New chat Able
正在加载,请稍候...