TENC1 Polyclonal antibody

• 

  WB analysis using 28153-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28153-1-AP (TENC1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 28153-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28153-1-AP (TENC1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 28153-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28153-1-AP (TENC1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TENC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28153-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C1 TEN, C1TEN, DKFZp686D13244, FLJ16320, KIAA1075, TENC1, Tensin 2, TNS2

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28153-1-AP targets TENC1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27731

  Product name: Recombinant human TENC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 508-724 aa of BC142668

  Sequence: SVSSDSGHSSTLTTEPAAESPGRPPPTAAERQELDRLLGGCGVASGGRGAGRETAILDDEEQPTVGGGPHLGVYPGHRPGLSRHCSCRQGYREPCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYAEASMEKRRLCRSLSEGLYPYPPEMGKPATGDFGYRAPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLRLEREAGEGWASEAGKP

• Full Name: tensin like C1 domain containing phosphatase (tensin 2)
• Calculated Molecular Weight: 1419 aa, 154 kDa
• Observed Molecular Weight: 140-153 kDa
• GenBank Accession Number: BC142668
• Gene Symbol: TENC1
• Gene ID (NCBI): 23371
• RRID: AB_3086032
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q63HR2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.