Product Information
27586-1-AP targets TERT in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26270 Product name: Recombinant human TERT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 219-320 aa of NM_001193376 Sequence: MPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTP Predict reactive species |
| Full Name | telomerase reverse transcriptase |
| Calculated Molecular Weight | 127 kDa |
| Observed Molecular Weight | ~100 kDa |
| GenBank Accession Number | NM_001193376 |
| Gene Symbol | TERT |
| Gene ID (NCBI) | 7015 |
| RRID | AB_3085971 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14746 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Telomerase reverse transcriptase (TERT) is a catalytic subunit of telomerase. TERT plays a key role in cancer formation, ensuring chromosomal stability by maintaining telomere length, and allowing cells to avert senescence. It constitutes a limiting factor for formation of the telomerase complex in cancer cells. TERT is one of two major components of the larger telomerase complex, which extends telomeres by adding specific short repetitive DNA sequences. Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. The calculated MW of TERT is 127 kDa, 27586-1-AP can detect a band around 100 kDa.
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Chem Biol Interact Telomerase reverse transcriptase protects against diabetic kidney disease by promoting AMPK/PGC-1a-regulated mitochondrial energy homeostasis | ||
Transl Cancer Res Effect and mechanism of curcumin on colon cancer cell senescence through early growth response 1 (EGR1) | ||
Int J Biol Macromol NRF2-TERT-ACSL4 pathway inhibits ferroptosis and regulates cytoskeletal dynamics to mitigate ovarian aging.
| ||
FASEB J CAF-Secreted Exosomes Deliver BMP4 to Confer Radiotherapy Resistance in Cervical Cancer Through a Novel Mechanism Linking Nrf2 Activation to Cuproptosis Inhibition. | ||
J Tissue Eng Establishing an hTERT-driven immortalized umbilical cord-derived mesenchymal stem cell line and its therapeutic application in mice with liver failure | ||
Nat Commun Time-resolved multiomics profiling reveals chromatin O-GlcNAc modification promotes senescence-associated transcriptional program. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nancy (Verified Customer) (01-30-2026) | Good antibody for WB.
 |
