Tested Applications
| Positive WB detected in | HEK-293 cells, K-562 cells, MCF-7 cells, mouse testis tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF/ICC detected in | A549 cells, HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10258-1-AP targets Testin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0379 Product name: Recombinant human TES protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 108-323 aa of BC001451 Sequence: TVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHL Predict reactive species |
| Full Name | testis derived transcript (3 LIM domains) |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 38-48 kDa |
| GenBank Accession Number | BC001451 |
| Gene Symbol | TES |
| Gene ID (NCBI) | 26136 |
| RRID | AB_2201712 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UGI8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Testin (TES) is a cytoskeleton-associated protein that localizes along actin stress fibers at cell-cell contact areas and at focal adhesion plaques. It interacts with a variety of cytoskeletal proteins and gets involved in regulation of cell adhesion and migration. TES is a putative tumor suppressor and reduced expression of TES has been reported in various cancers. In addition, TES is a marker for Sertoli-Germ Cell junction and is useful to monitor the disruption of intercellular junctions in the testis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Testin antibody 10258-1-AP | Download protocol |
| IHC protocol for Testin antibody 10258-1-AP | Download protocol |
| IP protocol for Testin antibody 10258-1-AP | Download protocol |
| WB protocol for Testin antibody 10258-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Testin Polyclonal antibody (Cat# 10258-1-AP) has 6 citations published in Mol Neurobiol, Chem Biol Interact, Front Mol Biosci, J Biochem Mol Toxicol, Biol Reprod, and Oncol Lett. Research fields span oncology (osteosarcoma, breast cancer, astrocytoma), neurobiology (exosome-mediated astrocyte activation), reproductive biology (seminiferous tubule architecture and sperm development), and gastroenterology/inflammation (intestinal epithelial barrier in Crohn's disease-like colitis). Applications cited include WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Mol Neurobiol Exosomes Derived from Meningitic Escherichia coli-Infected Brain Microvascular Endothelial Cells Facilitate Astrocyte Activation | ||
Chem Biol Interact The JNK/P38 signaling pathway activated by Testin protects the intestinal epithelial barrier against Crohn's disease-like colitis | ||
Front Mol Biosci Development and Verification of a Hypoxic Gene Signature for Predicting Prognosis, Immune Microenvironment, and Chemosensitivity for Osteosarcoma. | ||
J Biochem Mol Toxicol D-Mannose Upregulates Testin via the NF-κB Pathway to Inhibit Breast Cancer Proliferation.
| ||
Biol Reprod The Aryl Hydrocarbon Receptor Is Important for Proper Seminiferous Tubule Architecture and Sperm Development in Mice. | ||
Oncol Lett Testin (TES) as a candidate tumour suppressor and prognostic marker in human astrocytoma. |
Reviews
What customers say
The single review for this antibody is positive, rated 5 stars. The user reported that the antibody works well for Western Blot, recognizing both endogenous and exogenous TES protein. In their experiment, the first lane showed cells expressing GFP-TES while the second lane contained wildtype cells, and the antibody detected TES in both. The application was Western Blot on MDCK GII cells, using a 1:1,000 dilution. Overall, the feedback highlights reliable performance and clear detection of the target.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joleen (Verified Customer) (06-07-2019) | The antibody works well. The first lane are cells expressing GFP-TES and the second lane is just wildtype cells. The antibody recognizes both endogenous and exogenous TES.
 |
