TESC Polyclonal antibody

• 

  WB analysis using 11125-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11125-1-AP (TESC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11125-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11125-1-AP (TESC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 11125-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 11125-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 11125-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11125-1-AP (TESC antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse brain using 11125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11125-1-AP (TESC antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 11125-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TESC antibody (11125-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• Featured Product
• KD/KO Validated

TESC Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11125-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TSC, Tescalcin, CHP3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, HeLa cells, rat brain tissue
• Positive IHC detected in: human colon cancer tissue, human pancreas cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 7 publications below
• IHC: See 8 publications below

Product Information

11125-1-AP targets TESC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1596

  Product name: Recombinant human TESC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of BC015221

  Sequence: MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH

• Full Name: tescalcin
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC015221
• Gene Symbol: TESC
• Gene ID (NCBI): 54997
• RRID: AB_2201727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BS2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Genome Biol; Long non-coding RNA ROR decoys gene-specific histone methylation to promote tumorigenesis.; Authors - Jiayan Fan
mouse	WB	J Neurosci; CHP1-Mediated NHE1 Biosynthetic Maturation Is Required for Purkinje Cell Axon Homeostasis.; Authors - Liu Ye Y
human	WB,IHC	Cancer Commun (Lond); Tescalcin is an unfavorable prognosis factor that regulats cell proliferation and survival in hepatocellular carcinoma patients.; Authors - Zhong-Guo Zhou ; KD Validated
human	IHC	Front Oncol; The Expression Profile, Clinical Application and Potential Tumor Suppressing Mechanism of hsa_circ_0001675 in Head and Neck Carcinoma.; Authors - Yujie Cao
human	WB	Oncol Rep; Differential expression of tescalcin by modification of promoter methylation controls cell survival in gastric cancer cells.; Authors - Tae Woo Kim
human	IHC	BMC Cancer; Tescalcin promotes highly invasive papillary thyroid microcarcinoma by regulating FOS/ERK signaling pathway.; Authors - Xiuhe Zou