TEX264 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TEX264 Polyclonal antibody, PBS Only (25858-1-PBS)

• 

  WB analysis using 25858-1-AP (same clone as 25858-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25858-1-AP (TEX264 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25858-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 25858-1-AP (same clone as 25858-1-PBS)

  WB result of TEX264 antibody (25858-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TEX264 transfected HEK-293 cells. This data was developed using the same antibody clone with 25858-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25858-1-AP (same clone as 25858-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25858-1-AP (TEX264 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25858-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 25858-1-AP (same clone as 25858-1-PBS)

  IP result of anti-TEX264 (IP:25858-1-AP, 4ug; Detection:25858-1-AP 1:3000) with HEK-293 cells lysate 1800 ug. This data was developed using the same antibody clone with 25858-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 25858-1-AP (same clone as 25858-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25858-1-AP (TEX264 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25858-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 25858-1-AP (same clone as 25858-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using TEX264 antibody (25858-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25858-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TEX264 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 25858-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

SIG11, TEG 264, Testis-expressed protein 264, TEX 264, UNQ337/PRO536

---

Product Information

25858-1-PBS targets TEX264 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23027

  Product name: Recombinant human TEX264 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-313 aa of BC008742

  Sequence: VEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE

• Full Name: testis expressed 264
• Calculated Molecular Weight: 313 aa, 34 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC008742
• Gene Symbol: TEX264
• Gene ID (NCBI): 51368
• RRID: AB_2880272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6I9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TEX264 (testes expressed gene 264) is a single-pass transmembrane protein, consisting of an N-terminal hydrophobic region, a gyrase inhibitory (GyrI)-like domain, and a loosely structured C terminus. TEX264 was first identified as an endoplasmic reticulum (ER)-resident Atg8-family-binding protein that mediates the degradation of portions of the ER during starvation (i.e., reticulophagy). TEX264 was identified as a cofactor of VCP/p97 ATPase that promotes the repair of covalently trapped TOP1 (DNA topoisomerase 1)-DNA crosslinks.