TFAP2A/AP-2 Polyclonal antibody

• 

  WB analysis using 13019-3-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13019-3-AP (TFAP2A/AP-2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 13019-3-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 13019-3-AP (TFAP2A/AP-2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 13019-3-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TFAP2A/AP-2 antibody (13019-3-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

TFAP2A/AP-2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13019-3-AP

Publications(15)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

TFAP2A, TFAP2A,AP-2, Activating enhancer-binding protein 2-alpha, AP 2, AP 2alpha

---

Tested Applications

• Positive WB detected in: HepG2 cells, Y79 cells, MCF-7 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 1 publications below
• IP: See 1 publications below
• ChIP: See 5 publications below

Product Information

13019-3-AP targets TFAP2A/AP-2 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4112

  Product name: Recombinant human TFAP2A,AP-2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 79-431 aa of BC017754

  Sequence: LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

• Full Name: transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
• Calculated Molecular Weight: 431 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC017754
• Gene Symbol: TFAP2A/AP-2
• Gene ID (NCBI): 7020
• RRID: AB_2199414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05549
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The activator protein-2 (AP-2) family of transcription factors comprises five 52-kDa isoforms (AP-2α, AP-2β, AP-2γ, AP-2δ, and AP-2ε), which share a common structure: a proline/glutamine-rich transactivation domain in the N-terminal region and a helix-span-helix domain in the C-terminal region, which mediates dimerization and site-specific DNA binding. Depending on the cellular context, the AP-2 transcription factors are individually associated either with cell differentiation and development or with cancer progression/regression (PMID: 21966377). TFAP2A (AP-2-alpha) is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation (PMID: 11694877).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dev Cell; Mitochondrial CCN1 drives ferroptosis via fatty acid β-oxidation; Authors - Wanxin Guo
mouse	WB,IHC	J Ethnopharmacol; Erzhi Pill promotes norepinephrine synthesis in locus coeruleus through ERβ-TFAP2A-TH plays a neuroprotective role; Authors - Ao Xue
		Oncol Rep; Regulation of DEK expression by AP-2α and methylation level of DEK promoter in hepatocellular carcinoma.; Authors - Ming-Xu Qiao
mouse,human	WB,ChIP	Acta Pharmacol Sin; Hepatitis B virus X protein promotes human hepatoma cell growth via upregulation of transcription factor AP2α and sphingosine kinase 1.; Authors - Zhan-Ping Lu ; KD Validated
human	WB	Cancer Cell Int; HNRNPC promotes progression of non-small cell lung cancer by maintaining TFAP2A mRNA stability; Authors - Minghua Liao
	ChIP	Cell Death Dis; TFAP2A potentiates lung adenocarcinoma metastasis by a novel miR-16 family/TFAP2A/PSG9/TGF-β signaling pathway.; Authors - Yanlu Xiong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alessandro (Verified Customer) (12-09-2023)

good IF antibody. no unspecific staining

• Applications: Immunofluorescence
• Cell Tissue Type: Retinal organoids