Tested Applications
| Positive WB detected in | BT-549 cells, HeLa cells, Y79 cells, HEK-293T cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13019-3-AP targets TFAP2A/AP-2 in WB, IHC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4112 Product name: Recombinant human TFAP2A,AP-2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 79-431 aa of BC017754 Sequence: LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK Predict reactive species |
| Full Name | transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) |
| Calculated Molecular Weight | 431 aa, 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC017754 |
| Gene Symbol | TFAP2A/AP-2 |
| Gene ID (NCBI) | 7020 |
| RRID | AB_2199414 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05549 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The activator protein-2 (AP-2) family of transcription factors comprises five 52-kDa isoforms (AP-2α, AP-2β, AP-2γ, AP-2δ, and AP-2ε), which share a common structure: a proline/glutamine-rich transactivation domain in the N-terminal region and a helix-span-helix domain in the C-terminal region, which mediates dimerization and site-specific DNA binding. Depending on the cellular context, the AP-2 transcription factors are individually associated either with cell differentiation and development or with cancer progression/regression (PMID: 21966377). TFAP2A (AP-2-alpha) is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation (PMID: 11694877).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TFAP2A/AP-2 antibody 13019-3-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TFAP2A/AP-2 Polyclonal antibody (Cat# 13019-3-AP) has 27 citations. They appear in journals including Drug Resistance Updates, Journal of Experimental & Clinical Cancer Research, Advanced Science, Cell Reports Medicine, Cell Death & Disease, Developmental Cell, Cancer Cell International, Communications Biology, Molecular Cancer Research, Journal of Neurochemistry, and bioRxiv. Research fields span oncology (lung, liver, gastric, cervical, breast, colorectal, renal, and melanoma cancers), drug resistance, ferroptosis, autophagy, neurology (Alzheimer's, depression, neuroprotection), and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Drug Resist Updat DEAF1 confers resistance to adriamycin-induced apoptosis and pyroptosis in multiple myeloma. | ||
J Exp Clin Cancer Res Transcriptional and post-transcriptional regulation of CARMN and its anti-tumor function in cervical cancer through autophagic flux blockade and MAPK cascade inhibition | ||
Adv Sci (Weinh) Overcoming Cancer Persister Cells by Stabilizing the ATF4 Promoter G-quadruplex | ||
Cell Rep Med Alarmin S100A8 imparts chemoresistance of esophageal cancer by reprogramming cancer-associated fibroblasts | ||
Cell Death Dis The m6A modification-mediated OGDHL exerts a tumor suppressor role in ccRCC by downregulating FASN to inhibit lipid synthesis and ERK signaling | ||
Cell Death Dis TFAP2A potentiates lung adenocarcinoma metastasis by a novel miR-16 family/TFAP2A/PSG9/TGF-β signaling pathway. |
Reviews
What customers say
The single review for this product is highly positive, rated 5 stars. The user tested it for immunofluorescence on retinal organoids and reported it to be a good IF antibody with no unspecific staining. Overall, the feedback highlights strong specificity and reliable performance in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alessandro (Verified Customer) (12-09-2023) | good IF antibody. no unspecific staining
|
