TFAP2B Polyclonal antibody

• 

  WB analysis of MCF-7 using 13183-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13183-1-AP (TFAP2B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 13183-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13183-1-AP (TFAP2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 13183-1-AP

  IP result of anti-TFAP2B (IP:13183-1-AP, 4ug; Detection:13183-1-AP 1:500) with MCF-7 cells lysate 800ug.

TFAP2B Polyclonal Antibody for WB, IP, ELISA

Cat No. 13183-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

AP 2B, AP2 B, AP2 beta, TFAP2B, Transcription factor AP 2 beta

---

Tested Applications

• Positive WB detected in: MCF7 cells, MCF-7 cells
• Positive IP detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

13183-1-AP targets TFAP2B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3853

  Product name: Recombinant human TFAP2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-460 aa of BC037225

  Sequence: RQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK

• Full Name: transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
• Calculated Molecular Weight: 449 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC037225
• Gene Symbol: TFAP2B
• Gene ID (NCBI): 7021
• RRID: AB_2286992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92481
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncol Lett; miR-142-5p promotes renal cell tumorigenesis by targeting TFAP2B.; Authors - Maoshu Zhu