TFAP2B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TFAP2B Polyclonal antibody (13183-1-AP)

TFAP2B Polyclonal Antibody for WB, IP, ELISA

Cat No. 13183-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

AP 2B, AP2 B, AP2 beta, TFAP2B, Transcription factor AP 2 beta

• 

  WB analysis of MCF-7 using 13183-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13183-1-AP (TFAP2B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 13183-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13183-1-AP (TFAP2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 13183-1-AP

  IP result of anti-TFAP2B (IP:13183-1-AP, 4ug; Detection:13183-1-AP 1:500) with MCF-7 cells lysate 800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TFAP2B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF7 cells, MCF-7 cells
• Positive IP detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13183-1-AP targets TFAP2B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3853

  Product name: Recombinant human TFAP2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-460 aa of BC037225

  Sequence: RQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK

• Full Name: transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
• Calculated Molecular Weight: 449 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC037225
• Gene Symbol: TFAP2B
• Gene ID (NCBI): 7021
• RRID: AB_2286992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92481
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TFAP2B Polyclonal antibody (Cat# 13183-1-AP) has 2 citations. These appear in Frontiers in Cell and Developmental Biology and Oncology Letters. The research fields span renal developmental biology (nephron progenitor cell maintenance and distal nephron development) and cancer biology (renal cell tumorigenesis via miR-142-5p targeting TFAP2B).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Front Cell Dev Biol; Transcription factors ETV4 and ETV5 are required for nephron progenitor cell maintenance, distal nephron development and connection to the collecting system.; Authors - Kaitlin Day
human	WB	Oncol Lett; miR-142-5p promotes renal cell tumorigenesis by targeting TFAP2B.; Authors - Maoshu Zhu