TFAP2E Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TFAP2E Polyclonal antibody (25829-1-AP)

TFAP2E Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25829-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AP2 epsilon, AP2E, TFAP2E

• 

  WB analysis of A375 using 25829-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 25829-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 25829-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 25829-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 25829-1-AP (TFAP2E Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 25829-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 25829-1-AP (TFAP2E antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 25829-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 25829-1-AP (TFAP2E antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A375 using 25829-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using 25829-1-AP (TFAP2E antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TFAP2E in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A375 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25829-1-AP targets TFAP2E in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23023

  Product name: Recombinant human TFAP2E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 58-219 aa of BC041175

  Sequence: YGQAPDAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPPARALGLDPRRDYATAVPRLLHGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLLDQSVIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSL

• Full Name: transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)
• Calculated Molecular Weight: 442 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC041175
• Gene Symbol: TFAP2E
• Gene ID (NCBI): 339488
• RRID: AB_2880258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6VUC0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TFAP2E Polyclonal antibody (Cat# 25829-1-AP) has 1 citation to date. It was cited in eLife (2022) in a study investigating the role of Tfap2e/AP-2ε in vomeronasal sensory neurons and sociosexual behavior in mice. The research field is neuroscience, specifically related to olfactory signaling and behavioral regulation. The antibody was used for immunofluorescence (IF) in mouse tissue.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Elife; Sociosexual behavior requires both activating and repressive roles of Tfap2e/AP-2ε in vomeronasal sensory neurons; Authors - Jennifer M Lin