TFF2 Recombinant monoclonal antibody, PBS Only

TFF2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA
Cat No. 83717-4-PBS
Clone No.240661G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), IP, ELISA

SML1, 240661G12, trefoil factor 2, Spasmolytic polypeptide, Spasmolysin

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83717-4-PBS targets TFF2 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4537

Product name: Recombinant human TFF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-129 aa of BC032820

Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Predict reactive species
Full Name trefoil factor 2
Calculated Molecular Weight 129 aa, 14 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC032820
Gene Symbol TFF2
Gene ID (NCBI) 7032
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ03403
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).

Loading...
||
New chat Able
正在加载,请稍候...