TFPI Polyclonal antibody

TFPI Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 31765-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

EPI, Extrinsic pathway inhibitor, LACI, Lipoprotein-associated coagulation inhibitor, TFI

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31765-1-AP targets TFPI in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg0855

Product name: Recombinant Human TFPI protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*His

Domain: 29-282 aa of NM_006287.6

Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

Predict reactive species
Full Name tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
Calculated Molecular Weight35 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberNM_006287.6
Gene Symbol TFPI
Gene ID (NCBI) 7035
RRIDAB_3670106
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP10646-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tissue factor pathway inhibitor (TFPI) is an anticoagulant protein produced primarily by the endothelium and megakaryocytes and alternative mRNA splicing generates two main forms, TFPIα and TFPIβ (PMID: 26149025, PMID: 16246254). TFPIα is a soluble form of TFPI. It is a ~46 kDa glycoprotein and consists of an acidic N-terminal regionfollowed by three tandem, Kunitz-type protease inhibitor domains and a basic C-terminal region. Based on protein mass, TFPIβ (28 kDa) is considerably smaller than TFPIα (36 kDa), but both migrate with the same apparent molecular mass (46 kDa) on sodium dodecylsulfatepolyacrylamide gel electrophoresis (SDS-PAGE), suggesting a difference in post-translational modifications (PMID: 16246254). TFPI associated with LDLis 34 kDa and lacks a substantial portion of the carboxy terminus including at least a portion of the third Kunitz domain. TFPI associated with HDL is 41 kDa and is in part a mixed disulphide complex between TFPI and apolipoprotein All (PMID: 8979119). TFPI exerts its anticoagulant effects by inhibiting TF-FVIIa in a manner that is dependent on its inhibition of factor Xa (FXa) (PMID: 2927510).

Protocols

Product Specific Protocols
IF protocol for TFPI antibody 31765-1-APDownload protocol
WB protocol for TFPI antibody 31765-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...