• Featured Product
  • KD/KO Validated

HIC5 Polyclonal antibody

HIC5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10565-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Androgen receptor-associated protein of 55 kDa, ARA55, Hic-5, Hydrogen peroxide-inducible clone 5 protein, TGFB1I1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A431 cells, mouse colon tissue, rat colon tissue
Positive IP detected inA431 cells
Positive IHC detected inhuman spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10565-1-AP targets HIC5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0868

Product name: Recombinant human TGFB1I1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-230 aa of BC001830

Sequence: MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAW

Predict reactive species
Full Name transforming growth factor beta 1 induced transcript 1
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48-50 kDa
GenBank Accession NumberBC001830
Gene Symbol HIC5
Gene ID (NCBI) 7041
RRIDAB_2202045
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43294
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for HIC5 antibody 10565-1-APDownload protocol
IHC protocol for HIC5 antibody 10565-1-APDownload protocol
IP protocol for HIC5 antibody 10565-1-APDownload protocol
WB protocol for HIC5 antibody 10565-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,mouseWB,IHC,IF

Acta Pharmacol Sin

GPR97 deficiency ameliorates renal interstitial fibrosis in mouse hypertensive nephropathy

Authors - Ji-Chao Wu
humanWB,IHC,IF

Aging (Albany NY)

Exosome-mediated Hic-5 regulates proliferation and apoptosis of osteosarcoma via Wnt/β-catenin signal pathway.

Authors - Liansheng Sha
  • KD Validated
humanWB

Eur J Pharmacol

Vitamin D3 analogue calcipotriol inhibits the profibrotic effects of transforming growth factor- β1 on pancreatic stellate cells

Authors - Meifang Zheng
humanWB

J Proteome Res

Quantitative proteomics implicates Rictor/mTORC2 in cell adhesion.

Authors - Hao Wang
humanIHC,IF

Cell Death Dis

HIC-5 in cancer-associated fibroblasts contributes to esophageal squamous cell carcinoma progression.

Authors - Xuanling Du
humanIHC

Med Sci Monit

Bioinformatics Profiling and Experimental Validation of 4 Differentially-Expressed LIM Genes in the Course of Colorectal-Adenoma-Carcinoma

Authors - Ying He
Loading...
||
New chat Able
正在加载,请稍候...