TGFBR1 Recombinant monoclonal antibody, PBS Only

TGFBR1 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 84453-1-PBS
Clone No.241441A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Activin receptor-like kinase 5, Activin receptor like kinase 5, Activin A receptor type II-like protein kinase of 53kD, AAT5, 241441A11

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84453-1-PBS targets TGFBR1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag31620

Product name: Recombinant human TGFBR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 34-180 aa of NM_004612

Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL

Predict reactive species
Full Name transforming growth factor, beta receptor 1
Calculated Molecular Weight56KD
Observed Molecular Weight56 kDa
GenBank Accession NumberNM_004612
Gene Symbol TGFBR1
Gene ID (NCBI) 7046
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP36897
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TGFBR1 (TGF-beta receptor type-1) encodes a serine/threonine kinase receptor for transforming growth factor-beta. TGFB1, TGFB2 and TGFB3 signals are transduced from the cell surface to the cytoplasm and regulate lots of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Mutations in both TGFBR2 and TGFBR1 were associated with early onset and aggressive thoracic aortic disease with MFS-like skeletal features, but also hypertelorism, craniosynostosis, developmental delay, cleft palate and bifid uvula, congenital heart disease and aneurysms, and dissections throughout the arterial tree with marked arterial tortuosity (PMID: 15731757, PMID: 27879313).

Loading...
||
New chat Able
正在加载,请稍候...