TGFBR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TGFBR2 Polyclonal antibody (27212-1-AP)

TGFBR2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27212-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, ELISA

Synonyms

EC:2.7.11.30, TbetaR-II, TGF beta receptor type 2, TGF-beta receptor type II, TGF-beta receptor type-2

• 

  WB analysis using 27212-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27212-1-AP (TGFBR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27212-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27212-1-AP (TGFBR2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27212-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27212-1-AP (TGFBR2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TGFBR2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, COLO320 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27212-1-AP targets TGFBR2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25767

  Product name: Recombinant human TGFBR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-166 aa of BC040499

  Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ

• Full Name: transforming growth factor, beta receptor II (70/80kDa)
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65-80 kDa
• GenBank Accession Number: BC040499
• Gene Symbol: TGFBR2
• Gene ID (NCBI): 7048
• RRID: AB_2918119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P37173
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 result in both SMAD4-dependent constraint of proliferation and SMAD4-independent activation of apoptosis (PMID: 29396446). The calculated molecular weight of TGFBR2 is 65 kDa. It has some isoforms with the molecular weight of 70-80 kDa and ~90 kDa after glycosylated.

Publications

What published studies show

The TGFBR2 Polyclonal antibody (Cat# 27212-1-AP) has 13 citations published in journals including Cell Chem Biol, Cell Commun Signal, Front Pharmacol, iScience, Oncogene, Exp Eye Res, Biology, Biochim Biophys Acta Mol Cell Res, Theriogenology, Acta Histochem, Reprod Sci, and Int J Rheum Dis. Research fields span pulmonary fibrosis, TGF-β/SMAD signaling, epithelial-mesenchymal transition, pancreatic cancer liver metastasis, ovarian dysfunction, rheumatoid arthritis, and prostate cancer bone metastasis.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Cell Commun Signal; The activation of PPARγ enhances Treg responses through up-regulating CD36/CPT1-mediated fatty acid oxidation and subsequent N-glycan branching of TβRII/IL-2Rα.; Authors - Yumeng Miao
human	WB	Cell Chem Biol; Therapeutic potency of compound RMY-205 for pulmonary fibrosis induced by SARS-CoV-2 nucleocapsid protein; Authors - Zhi-Yuan Zhang
mouse	WB	Front Pharmacol; Tangeretin attenuates bleomycin-induced pulmonary fibrosis by inhibiting epithelial-mesenchymal transition via the PI3K/Akt pathway; Authors - Jiang Li
mouse,human	WB,IHC	Front Pharmacol; 2,3,5,4'-tetrahydroxystilbene-2-O-β-D-glucoside ameliorates bleomycin-induced pulmonary fibrosis via regulating pro-fibrotic signaling pathways; Authors - Tsung-Teng Huang
human	WB	iScience; RRM2 promotes liver metastasis of pancreatic cancer by stabilizing YBX1 and activating the TGF-beta pathway; Authors - Zhouyuan Du
	WB	Biology (Basel); miR-134-3p Regulates Cell Proliferation and Apoptosis by Targeting INHBA via Inhibiting the TGF-β/PI3K/AKT Pathway in Sheep Granulosa Cells; Authors - Xinai Huang