TGFBR3 Polyclonal antibody

• 

  WB analysis using 28992-1-AP

  Human placenta tissue was subjected to SDS PAGE followed by western blot with 28992-1-AP (TGFBR3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

TGFBR3 Polyclonal Antibody for WB, ELISA

Cat No. 28992-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

TGF-beta receptor type 3, TGF-beta Receptor III, TGF beta receptor type III, TGF beta receptor type 3, BGCAN

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28992-1-AP targets TGFBR3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29397

  Product name: Recombinant human TGFBR3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 145-369 aa of BC136295

  Sequence: TAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHT

• Full Name: transforming growth factor, beta receptor III
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC136295
• Gene Symbol: TGFBR3
• Gene ID (NCBI): 7049
• RRID: AB_3086094
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03167
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transforming growth factor β (TGF-β) is a multifunctional cytokine that plays important roles in normal development and homeostasis (PMID: 8530052). There are three TGF-β forms: TGF-β1, TGF-β2, and TGF-β3. The diverse effects of TGF-β are mediated by the TGF-β receptors and cell surface-binding proteins. Three TGF-beta receptors exist: TGFBR1, TFGBR2, TGFBR3 (PMID: 8530052; 30184463). TGFBR3, also known as betaglycan, is a transmembrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. In addition to the transmembrane form, the extracellular domain of TGFBR3 can be cleaved to a soluble form (sTGFBR3), which may serve as an antagonist of TGF-β to inhibit TGF-β signaling (PMID: 30184463). TGFBR3 has a larger apparent molecular weight than the calculated molecular weight, due to extensive carbohydrate modifications (PMID: 1556106).