• Featured Product
  • KD/KO Validated

TGIF2 Polyclonal antibody

TGIF2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11522-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

TGF-beta-induced transcription factor 2, TGFB induced factor homeobox 2, TGFB induced factor 2, Homeobox protein TGIF2, 5'-TG-3'-interacting factor 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, Daudi cells, HL-60 cells, Jurkat cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11522-1-AP targets TGIF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2085

Product name: Recombinant human TGIF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-237 aa of BC012816

Sequence: MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ

Predict reactive species
Full Name TGFB-induced factor homeobox 2
Calculated Molecular Weight 237 aa, 26 kDa
Observed Molecular Weight28 kDa and 30 kDa
GenBank Accession NumberBC012816
Gene Symbol TGIF2
Gene ID (NCBI) 60436
RRIDAB_2202731
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9GZN2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transforming growth factor-beta-induced factor 2(TGIF2), is a member of a subfamily of transcription factor with a TALE(3-amino acid loop extension), an atypical homeodomain. It also contains a proline-rich region, which is a putative SH3 domain-binding site and suggested involve in transcriptional regulation. It is highly expressed in the heart, kidney, and testis, but low in the brain and prostate. Through binding directly to the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins, TGIF2 acts as a transcriptional repressor. The calculated molecular weight of TGIF2 is 26 kDa, but the phosphorylated TGIF2 is about 30-35 kDa protein. This antibody detected two forms of bands of about 28 and 30 kDa, and the upper band appears to result from increased phosphorylation (PMID: 11427533).

Protocols

Product Specific Protocols
IF protocol for TGIF2 antibody 11522-1-APDownload protocol
IHC protocol for TGIF2 antibody 11522-1-APDownload protocol
WB protocol for TGIF2 antibody 11522-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Rep

Tgif1 Counterbalances the Activity of Core Pluripotency Factors in Mouse Embryonic Stem Cells.

Authors - Bum-Kyu Lee
humanWB

Biochem J

The human RNA-binding protein RBFA promotes the maturation of the mitochondrial ribosome.

Authors - Agata Rozanska
humanWB

Exp Ther Med

Molecular mechanisms in vascular injury induced by hypertension: Expression and role of microRNA-34a.

Authors - Siguan Liu
mouseWB

Brain Behav

Downregulation of TGIF2 is possibly correlated with neuronal apoptosis and autism-like symptoms in mice.

Authors - Jing Lei
humanWB

Front Immunol

TGIF2 is a potential biomarker for diagnosis and prognosis of glioma

Authors - Wan Zhang
  • KD Validated
humanWB,IHC

Int J Biol Sci

Smad2 Cooperating with TGIF2 Contributes to EMT and Cancer Stem Cells Properties in Pancreatic Cancer via Co-Targeting SOX2

Authors - Fuqiang Zu
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...