TGIF2 Monoclonal antibody

TGIF2 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 67576-1-Ig
Clone No.2D6B6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, FC (Intra), ELISA

TGFB induced factor homeobox 2, TGFB induced factor 2, Homeobox protein TGIF2, 5'-TG-3'-interacting factor 2, 5 TG 3 interacting factor 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, THP-1 cells, COLO 320 cells, Ramos cells, Daudi cells, K-562 cells, Jurkat cells, HL-60 cells, MOLT-4 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67576-1-Ig targets TGIF2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30083

Product name: Recombinant human TGIF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-237 aa of BC012816

Sequence: MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ

Predict reactive species
Full Name TGFB-induced factor homeobox 2
Calculated Molecular Weight 237 aa, 26 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC012816
Gene Symbol TGIF2
Gene ID (NCBI) 60436
RRIDAB_2882789
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9GZN2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TGIF2, is a member of a subfamily of transcription factor with a TALE(3-amino acid loop extension), an atypical homeodomain. It also contains a proline-rich region, which is a putative SH3 domain-binding site and suggested involve in transcriptional regulation. It is highly expressed in the heart, kidney, and testis, but low in the brain and prostate. Through binding directly to the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins, TGIF2 acts as a transcriptional repressor. The calculated molecular weight of TGIF2 is 26 kDa, but the phosphorylated TGIF2 is about 30-35 kDa protein.

Protocols

Product Specific Protocols
WB protocol for TGIF2 antibody 67576-1-IgDownload protocol
FC protocol for TGIF2 antibody 67576-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Bosn J Basic Med Sci

Circ-RNF13, as an oncogene, regulates malignant progression of HBV-associated hepatocellular carcinoma cells and HBV infection through ceRNA pathway of circ-RNF13/miR-424-5p/TGIF2.

Authors - Yan Chen
Loading...
||
New chat Able
正在加载,请稍候...