TGM1 Monoclonal antibody, PBS Only

• 

  WB analysis of human saliva using 67004-1-Ig (same clone as 67004-1-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 67004-1-Ig (TGM1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67004-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67004-1-Ig (same clone as 67004-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67004-1-Ig (TGM1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67004-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 67004-1-Ig (same clone as 67004-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 67004-1-Ig (TGM1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67004-1-PBS in a different storage buffer formulation.

TGM1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67004-1-PBS

Clone No.3D9C11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EC:2.3.2.13, Epidermal TGase, ICR2, KTG, LI

---

Product Information

67004-1-PBS targets TGM1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3905

  Product name: Recombinant human TGM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 467-817 aa of BC034699

  Sequence: SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA

• Full Name: transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase)
• Calculated Molecular Weight: 817 aa, 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC034699
• Gene Symbol: TGM1
• Gene ID (NCBI): 7051
• RRID: AB_2882321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22735
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transglutaminase 1 is a epidermal enzyme that is expressed during the terminal differentiation of keratinized squamous epithelium to form cornified cell envelope in differentiated keratinocytes. Mutation of TGM1 has been linked to various epidermal diseases. This antibody recognizes the endogenous 90 kDa TGM1 proteins.