TGM1 Recombinant monoclonal antibody, PBS Only (Capture)

TGM1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 84032-2-PBS
Clone No.241218E12

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

LI, KTG, ICR2, Epidermal TGase, EC:2.3.2.13

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84032-2-PBS targets TGM1 as part of a matched antibody pair:

MP00951-1: 84032-2-PBS capture and 84032-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17969

Product name: Recombinant human TGM1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 467-817 aa of BC034699

Sequence: SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA

Predict reactive species
Full Name transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase)
Calculated Molecular Weight 817 aa, 90 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC034699
Gene Symbol TGM1
Gene ID (NCBI) 7051
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22735
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...