CTMP Polyclonal antibody

• 

  WB analysis of mouse brain using 14692-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14692-1-AP (CTMP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14692-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14692-1-AP (CTMP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 14692-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14692-1-AP (CTMP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 14692-1-AP

  IP result of anti-CTMP (IP:14692-1-AP, 4ug; Detection:14692-1-AP 1:500) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human endometrial cancer using 14692-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14692-1-AP (CTMP antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human endometrial cancer using 14692-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14692-1-AP (CTMP antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HeLa using 14692-1-AP

  Immunofluorescent analysis of Hela cells, using CTMP antibody 14692-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

CTMP Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14692-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

THEM4, EC:3.1.2.2, Carboxyl-terminal modulator protein, Acyl-coenzyme A thioesterase THEM4, Acyl-CoA thioesterase THEM4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HepG2 cells, mouse skeletal muscle tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IP: See 1 publications below

Product Information

14692-1-AP targets CTMP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6244

  Product name: Recombinant human THEM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-240 aa of BC065277

  Sequence: MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT

• Full Name: thioesterase superfamily member 4
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC065277
• Gene Symbol: CTMP
• Gene ID (NCBI): 117145
• RRID: AB_2271685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T1C6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Heliyon; PRAME promotes proliferation of multiple myeloma cells through CTMP/Akt/p21/CCND3 axis by ubiquitinating CTMP and p21; Authors - Kai Sun
	WB	FASEB J; Activation of SIK2 inhibits gluconeogenesis and alleviates lipogenesis-induced inflammatory response by SIK2-CRTC2-ACC1 in hepatocytes of large yellow croaker (Larimichthys crocea); Authors - Shangzhe Han