THEM4 Monoclonal antibody, PBS Only

• 

  WB analysis using 68923-1-Ig (same clone as 68923-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68923-1-Ig (THEM4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68923-1-PBS in a different storage buffer formulation.

THEM4 Monoclonal Antibody for WB, ELISA

Cat No. 68923-1-PBS

Clone No.1C12B9

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, ELISA

Synonyms

CTMP, EC:3.1.2.2, Carboxyl-terminal modulator protein, Acyl-coenzyme A thioesterase THEM4, Acyl-CoA thioesterase THEM4

---

Product Information

68923-1-PBS targets THEM4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6296

  Product name: Recombinant human THEM4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-240 aa of BC065277

  Sequence: MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT

• Full Name: thioesterase superfamily member 4
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC065277
• Gene Symbol: CTMP
• Gene ID (NCBI): 117145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5T1C6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

THEM4, which stands for thioesterase superfamily member 4, is a gene in humans that encodes a protein involved in the regulation of the protein kinase B (PKB), also known as Akt pathway. This gene is ubiquitously expressed in various tissues, with notable expression in the kidney and testis. THEM4 can also promote the proliferation of tumor cells by positively regulating Akt activity in breast cancer and nasopharyngeal carcinoma, which presents a contrasting role to its initial characterization.