THOC5 Polyclonal antibody

• 

  WB analysis using 14862-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14862-1-AP (THOC5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 14862-1-AP

  WB result of THOC5 antibody (14862-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-THOC5 transfected HEK-293 cells.

• 

  IP experiment of HEK-293 using 14862-1-AP

  IP result of anti-THOC5 (IP:14862-1-AP, 4ug; Detection:14862-1-AP 1:5000) with HEK-293 cells lysate 920 ug.

• 

  IHC staining of human lung cancer using 14862-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14862-1-AP (THOC5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 14862-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14862-1-AP (THOC5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 14862-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14862-1-AP (THOC5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 14862-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14862-1-AP (THOC5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 14862-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14862-1-AP (THOC5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 14862-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using THOC5 antibody (14862-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

THOC5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14862-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

C22orf19, Functional spliceosome-associated protein 79, KIAA0983

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human breast cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below

Product Information

14862-1-AP targets THOC5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6664

  Product name: Recombinant human THOC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 354-683 aa of BC003615

  Sequence: CKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTIAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR

• Full Name: THO complex 5
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 79 kDa
• GenBank Accession Number: BC003615
• Gene Symbol: THOC5
• Gene ID (NCBI): 8563
• RRID: AB_2878088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13769
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

THOC5, also named as C22orf19, or KIAA0983, is a 683 amino acid protein, which belongs to the THOC5 family. THOC5 is ubiquitously expressed in many tissues. THOC5 localizes in the nucleus and acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA.THOC5 plays a role in cytokine-stimulated monocytic development and affects granulocyte/macrophage differentiation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Cell Stem Cell; The THO Complex Regulates Pluripotency Gene mRNA Export and Controls Embryonic Stem Cell Self-Renewal and Somatic Cell Reprogramming.; Authors - Wang Li L ; KD Validated