THOC5 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of U2OS using 83435-1-RR (same clone as 83435-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using THOC5 antibody (83435-1-RR, Clone: 240013F7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83435-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 83435-1-RR (same clone as 83435-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using THOC5 antibody (83435-1-RR, Clone: 240013F7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83435-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 83435-1-RR (same clone as 83435-1-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug Thoc5 Recombinant Antibody (83435-1-RR, Clone:240013F7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83435-1-PBS in a different storage buffer formulation.

THOC5 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83435-1-PBS

Clone No.240013F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

KIAA0983, Functional spliceosome-associated protein 79, C22orf19, 240013F7

---

Product Information

83435-1-PBS targets THOC5 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6664

  Product name: Recombinant human THOC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 354-683 aa of BC003615

  Sequence: CKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTIAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR

• Full Name: THO complex 5
• Calculated Molecular Weight: 79 kDa
• GenBank Accession Number: BC003615
• Gene Symbol: THOC5
• Gene ID (NCBI): 8563
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13769
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.