THRA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• THRA Polyclonal antibody (10139-1-AP)

• Featured Product
• KD/KO Validated

THRA Polyclonal Antibody for WB, ELISA

Cat No. 10139-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EAR-7, EAR7, EAR 7, c-erbA-alpha, c-erbA-1

• 

  WB analysis of A431 using 10139-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10139-1-AP (THRA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10139-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10139-1-AP (THRA antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for THRA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10139-1-AP targets THRA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0182

  Product name: Recombinant human THRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-282 aa of BC002728

  Sequence: PSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAV

• Full Name: thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
• Calculated Molecular Weight: 490 aa, 54 kDa
• Observed Molecular Weight: 58 kDa, 50 kDa
• GenBank Accession Number: BC002728
• Gene Symbol: THRA
• Gene ID (NCBI): 7067
• RRID: AB_2202770
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10827
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

THRA Polyclonal antibody (Cat# 10139-1-AP) has 5 citations published in Thyroid, Hypertension Research, Liver Research, Physiological Behavior, and Domestic Animal Endocrinology. The research fields span thyroid endocrinology, neurocognitive dysfunction, oxidative stress and hypertension, hepatocyte proliferation, skeletal muscle energy metabolism, and maternal-fetal thyroid hormone dynamics.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Thyroid; Increased thyroid hormone action alleviates hippocampal damage by down-regulating neuronal type-Ⅰ interferon signaling/necroptosis in diabetes-associated cognitive dysfunction; Authors - Ling Tian
rat	WB	Hypertens Res; THRA1/PGC-1α/SIRT3 pathway regulates oxidative stress and is implicated in hypertension of maternal hypothyroid rat offspring; Authors - Jun Guo ; KD Validated
		Liver Res; Hsa-miR-637 inhibits human hepatocyte proliferation by targeting Med1-interacting proteins; Authors - Jing Liu
mouse	WB	Physiol Behav; Exposure to melamine cyanuric acid in adult mice caused motor activity and skeletal muscle energy metabolism disorder; Authors - Sijie Wang
	IHC	Domest Anim Endocrinol; Maternal nutrient restriction alters thyroid hormone dynamics in placentae of sheep having small for gestational age fetuses.; Authors - C B Steinhauser