THRA Polyclonal antibody

• 

  WB analysis of A431 using 10139-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10139-1-AP (THRA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10139-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10139-1-AP (THRA antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

THRA Polyclonal Antibody for WB, ELISA

Cat No. 10139-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EAR-7, EAR7, EAR 7, c-erbA-alpha, c-erbA-1

---

Tested Applications

• Positive WB detected in: A431 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

10139-1-AP targets THRA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0182

  Product name: Recombinant human THRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-282 aa of BC002728

  Sequence: PSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAV

• Full Name: thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
• Calculated Molecular Weight: 490 aa, 54 kDa
• Observed Molecular Weight: 58 kDa, 50 kDa
• GenBank Accession Number: BC002728
• Gene Symbol: THRA
• Gene ID (NCBI): 7067
• RRID: AB_2202770
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10827
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Hypertens Res; THRA1/PGC-1α/SIRT3 pathway regulates oxidative stress and is implicated in hypertension of maternal hypothyroid rat offspring; Authors - Jun Guo ; KD Validated
mouse	WB	Physiol Behav; Exposure to melamine cyanuric acid in adult mice caused motor activity and skeletal muscle energy metabolism disorder; Authors - Sijie Wang
	IHC	Domest Anim Endocrinol; Maternal nutrient restriction alters thyroid hormone dynamics in placentae of sheep having small for gestational age fetuses.; Authors - C B Steinhauser
mouse	WB	Thyroid; Increased thyroid hormone action alleviates hippocampal damage by down-regulating neuronal type-Ⅰ interferon signaling/necroptosis in diabetes-associated cognitive dysfunction; Authors - Ling Tian
		Liver Res; Hsa-miR-637 inhibits human hepatocyte proliferation by targeting Med1-interacting proteins; Authors - Jing Liu