THRA Monoclonal antibody

• 

  WB analysis of A431 using 66703-1-Ig

  WB result of THRA antibody (66703-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-THRA transfected A431 cells.

• 

  IHC staining of mouse brain using 66703-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66703-1-Ig (THRA antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66703-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66703-1-Ig (THRA antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 66703-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66703-1-Ig (THRA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 66703-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 66703-1-Ig (THRA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 66703-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 66703-1-Ig (THRA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 66703-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 66703-1-Ig (THRA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 66703-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using THRA antibody (66703-1-Ig, Clone: 1A11C8 ) at dilution of 1:1300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

THRA Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66703-1-Ig

Clone No.1A11C8

Publications(4)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1A11C8, AR7, c-erbA-1, c-erbA-alpha, EAR 7

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: mouse brain tissue, human thyroid cancer tissue, mouse heart tissue, rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:650-1:2600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

66703-1-Ig targets THRA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27189

  Product name: Recombinant human THRA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 44-282 aa of BC002728

  Sequence: PSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAV

• Full Name: thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
• Calculated Molecular Weight: 490 aa, 54 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC002728
• Gene Symbol: THRA
• Gene ID (NCBI): 7067
• RRID: AB_3085032
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10827
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Mol Cell Endocrinol; Exogenous Thyroxine Increases Cardiac GLUT4 Translocation in Insulin Resistant OLETF Rats; Authors - Dora A Mendez
pig	WB	Theriogenology; Thyroxine regulates pig Sertoli cell line proliferation and maturation through the IKK/NFκB and p38 MAPK signaling pathways; Authors - Jing Li
human	WB	Adv Sci (Weinh); A NRF2 Regulated and the Immunosuppressive Microenvironment Reversed Nanoplatform for Cholangiocarcinoma Photodynamic-Gas Therapy; Authors - Weimin Wang
mouse	WB	J Muscle Res Cell Motil; RNA-seq and ChIP-seq unveils thyroid hormone receptor α deficiency affects skeletal muscle myoblast proliferation and differentiation via Col6a1 during aging; Authors - Runqing Shi