• Featured Product
  • KD/KO Validated

THRSP Polyclonal antibody

THRSP Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 13054-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

S14, Spot 14 protein, SPOT14, THRSP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman liver tissue, human liver cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:100-1:600
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13054-1-AP targets THRSP in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3721

Product name: Recombinant human THRSP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-146 aa of BC031989

Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW

Predict reactive species
Full Name thyroid hormone responsive (SPOT14 homolog, rat)
Calculated Molecular Weight 146 aa, 17 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC031989
Gene Symbol THRSP
Gene ID (NCBI) 7069
RRIDAB_2877906
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92748
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

THRSP (Thyroid hormone-inducible hepatic protein)  is a protein that in humans is encoded by the THRSP gene. The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism (RefSeq). This antibody works well in IHC, WB and IF.

Protocols

Product Specific Protocols
WB protocol for THRSP antibody 13054-1-APDownload protocol
IHC protocol for THRSP antibody 13054-1-APDownload protocol
IP protocol for THRSP antibody 13054-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Med

Insulin-inducible THRSP maintains mitochondrial function and regulates sphingolipid metabolism in human adipocytes.

Authors - Maria A Ahonen
humanWB

Sci Rep

Elevated serum S14 levels are associated with more severe liver steatosis by ultrasonography.

Authors - Wen-Ti Lin
mouseWB

Mol Cell Endocrinol

MiR-451a attenuates free fatty acids-mediated hepatocyte steatosis by targeting the thyroid hormone responsive spot 14 gene.

Authors - Ni Zeng
  • KD Validated

Medicine (Baltimore)

Serum Spot 14 concentration is negatively associated with thyroid-stimulating hormone level.

Authors - Yen-Ting Chen
humanWB,IHC

Cell Death Discov

Thyroid hormones inhibit tumor progression and enhance the antitumor activity of lenvatinib in hepatocellular carcinoma via reprogramming glucose metabolism

Authors - Chun-Cheng Yang
mouseIHC

Adv Sci (Weinh)

Spatial Transcriptomic Study Reveals Heterogeneous Metabolic Adaptation and a Role of Pericentral PPARα/CAR/Ces2a Axis During Fasting in Mouse Liver

Authors - Shiguan Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

James (Verified Customer) (05-23-2025)

This antiboby works very well. Highly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: liver cells
THRSP Antibody Western Blot validation (1/1000 dilution) in liver cells (Cat no:13054-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...