Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue, human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:100-1:600 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13054-1-AP targets THRSP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3721 Product name: Recombinant human THRSP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC031989 Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW Predict reactive species |
| Full Name | thyroid hormone responsive (SPOT14 homolog, rat) |
| Calculated Molecular Weight | 146 aa, 17 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC031989 |
| Gene Symbol | THRSP |
| Gene ID (NCBI) | 7069 |
| RRID | AB_2877906 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92748 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
THRSP (Thyroid hormone-inducible hepatic protein) is a protein that in humans is encoded by the THRSP gene. The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism (RefSeq). This antibody works well in IHC, WB and IF.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for THRSP antibody 13054-1-AP | Download protocol |
| IP protocol for THRSP antibody 13054-1-AP | Download protocol |
| WB protocol for THRSP antibody 13054-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Spot14 antibody (catalog #13054-1-AP) has 9 total citations. These appear in journals including Hepatology, Advanced Science, Cell Death Discovery, Molecular Medicine, Scientific Reports, FASEB Journal, Molecular and Cellular Endocrinology, PLoS ONE, and Medicine (Baltimore). Research fields span liver disease (MASH, steatosis), hepatocellular carcinoma, glucose and lipid metabolism, adipocyte biology, thyroid hormone regulation, and bladder pain syndrome. Applications include WB, IHC, IP, and IF across human and mouse species.
| Species | Application | Title |
|---|---|---|
Hepatology MIF-mediated crosstalk between THRSP+ hepatocytes and CD74+ lipid-associated macrophages in hepatic periportal zone drives MASH
| ||
Adv Sci (Weinh) Spatial Transcriptomic Study Reveals Heterogeneous Metabolic Adaptation and a Role of Pericentral PPARα/CAR/Ces2a Axis During Fasting in Mouse Liver | ||
Cell Death Discov Thyroid hormones inhibit tumor progression and enhance the antitumor activity of lenvatinib in hepatocellular carcinoma via reprogramming glucose metabolism | ||
Mol Med Insulin-inducible THRSP maintains mitochondrial function and regulates sphingolipid metabolism in human adipocytes. | ||
Sci Rep Elevated serum S14 levels are associated with more severe liver steatosis by ultrasonography. | ||
FASEB J Artesunate remarkably alleviates interstitial cystitis/bladder pain syndrome in a murine model: Novel molecular signature deciphered by bulk tissue and single-cell transcriptomic analysis |
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application on liver cells at a 1:1000 dilution. The reviewer found the antibody performed very well and highly recommended it. Overall, the feedback is positive, indicating strong performance and satisfaction with the product's results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
James (Verified Customer) (05-23-2025) | This antiboby works very well. Highly recommended
 |
