THUMPD2 Polyclonal antibody

• 

  WB analysis using 21054-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21054-1-AP (THUMPD2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 21054-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using THUMPD2 antibody (21054-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

THUMPD2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21054-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

THUMP domain-containing protein 2, THUMP domain containing 2, C2orf8

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21054-1-AP targets THUMPD2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13736

  Product name: Recombinant human THUMPD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-473 aa of BC004163

  Sequence: IEENRDCQLEKQIKEETLEQRDFTTKSEKFQEEEFQNDIEKAIDTHNQNDLTFRVSCRCSGTIGKAFTAQEVGKVIGIAIMKHFGWKADLRNPQLEIFIHLNDIYSVVGIPVFRVSLASRAYIKTAGLRSTIAWAMASLADIKAGAFVLDPMCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLSEDHHRRLTDCKESNIPFNSKDSHTDEPGIKKCLNPEEKTGAFKTASTSFEASNHKFLDRMSPFGSLVPVECYKVSLGKTDAFICKYKKSHSSGL

• Full Name: THUMP domain containing 2
• Calculated Molecular Weight: 473 aa, 53 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC004163
• Gene Symbol: THUMPD2
• Gene ID (NCBI): 80745
• RRID: AB_3085634
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTF0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

THUMP domain-containing protein 2 (THUMPD2) is the methyltransferase, which interacts with an auxiliary protein, TRMT112, to catalyze U6 m2G72 formation. Western blot analysis detected THUMPD2 at an apparent molecular mass of 56 kDa.