TIA1 Recombinant monoclonal antibody, PBS Only

TIA1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 82672-1-PBS
Clone No.3N22

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

3N22, Cytotoxic granule associated RNA binding protein TIA1, Nucleolysin TIA-1 isoform p40, p40 TIA 1, p40-TIA-1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82672-1-PBS targets TIA1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2778

Product name: Recombinant human TIA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-214 aa of BC015944

Sequence: MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF

Predict reactive species
Full Name TIA1 cytotoxic granule-associated RNA binding protein
Calculated Molecular Weight 214 aa, 24 kDa, 43 kDa
Observed Molecular Weight38-40 kDa
GenBank Accession NumberBC015944
Gene Symbol TIA1
Gene ID (NCBI) 7072
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP31483
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TIA1, also named as p40-TIA-1, is involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). It possesses nucleolytic activity against cytotoxic lymphocyte target cells. TIA1 may be involved in apoptosis. Two isoforms of this protein exist - 41kDa and 42kDa. one of these was a missense variant (P362L) in TIA1. Similar to the ALS-related disease proteins TDP-43, hnRNPA1, and FUS, TIA1 is an RNA-binding protein containing a prionlike LCD and assembles into membrane-less organelles, including SGs. Postmortem neuropathology of five TIA1 mutations carriers showed a consistent pathological signature with numerous round, hyaline, TAR DNA-binding protein 43 (TDP-43)-positive inclusions.TIA1mutations significantly increased the propensity of TIA1 protein to undergo phase transition. In live cells,TIA1mutations delayed stress granule (SG) disassembly and promoted the accumulation of non-dynamic SGs that harbored TDP-43.

Loading...
||
New chat Able
正在加载,请稍候...