TIAM1 Polyclonal antibody

• 

  WB analysis using 27694-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27694-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HCT 116 using 27694-1-AP

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27694-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

TIAM1 Polyclonal Antibody for WB, ELISA

Cat No. 27694-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, ELISA

Synonyms

TIAM 1, TIAM1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HCT 116 cells, Neuro-2a cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

27694-1-AP targets TIAM1 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26777

  Product name: Recombinant human TIAM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 823-1002 aa of NM_003253

  Sequence: MQPEEDIYELLYKEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQV

• Full Name: T-cell lymphoma invasion and metastasis 1
• Calculated Molecular Weight: 178 kDa
• Observed Molecular Weight: 178 kDa
• GenBank Accession Number: NM_003253
• Gene Symbol: TIAM1
• Gene ID (NCBI): 7074
• RRID: AB_2918127
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13009
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); Phosphorylated SHMT2 Regulates Oncogenesis Through m6 A Modification in Lung Adenocarcinoma; Authors - Tianyu Han
mouse	WB	Acta Otolaryngol; C1QL1 regulates auditory nerve fibers growth via ELMO1-DOCK180-RAC1 integrin; Authors - Minglin Chen