TIAR Monoclonal antibody, PBS Only

TIAR Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 66907-1-PBS
Clone No.1E8D12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

TIAL1, 1E8D12, Nucleolysin TIAR, TCBP, TIA 1 related protein

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66907-1-PBS targets TIAR in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11981

Product name: Recombinant human TIAR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-252 aa of BC030025

Sequence: MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ

Predict reactive species
Full Name TIA1 cytotoxic granule-associated RNA binding protein-like 1
Calculated Molecular Weight 42 kDa
Observed Molecular Weight 39 and 41 kDa
GenBank Accession NumberBC030025
Gene Symbol TIAR
Gene ID (NCBI) 7073
RRIDAB_2882234
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01085
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TIAR, also named as TIA 1 related protein, is an RNA-binding protein which is associated with apoptosis. It has been shown that mouse with disrupted TIAR gene show high levels of embryonic lethality. TIAR plays an important role in cytoplasm and nucleus where it can control translation of some specific mRNAs and activate splicing of exons with weak 5-splice sites. 66907-1-Ig detects 39 and 41 kDa bands in SDS-PAGE. Besides, TIAR also has the 28 kDa and 50 kDa proteins for TIAR exists in multiple alternative splicing forms.(PMID: 12533540, 7533298, 22851315, 8176212)

Loading...
||
New chat Able
正在加载,请稍候...