TRIF/TICAM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRIF/TICAM1 Polyclonal antibody (23288-1-AP)

TRIF/TICAM1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23288-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

TICAM1, TRIF, MyD88-3, Proline-rich, vinculin and TIR domain-containing protein B, PRVTIRB

• 

  WB analysis using 23288-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 23288-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Ramos using 23288-1-AP

  Ramos cells were subjected to SDS PAGE followed by western blot with 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRIF/TICAM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MOLT-4 cells, Ramos cells, Raji cells
• Positive IHC detected in: human brain tissue, human testis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23288-1-AP targets TRIF/TICAM1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19779

  Product name: Recombinant human TICAM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC035331

  Sequence: LDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE

• Full Name: toll-like receptor adaptor molecule 1
• Calculated Molecular Weight: 712 aa, 76 kDa
• Observed Molecular Weight: 66-76 kDa
• GenBank Accession Number: BC035331
• Gene Symbol: TRIF
• Gene ID (NCBI): 148022
• RRID: AB_2879247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUC6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIF (adaptor-induced interferon-β containing the tir domain) is a key adapter protein in Toll-like receptor signaling, mediating the MyD88-independent pathway of TLR3 and TLR4. It activates NF-κB and interferon regulator 3 (IRF3), leading to the production of type I interferon and pro-inflammatory cytokines. TRIF recruits TRAF3 to activate TBK1/IKKε kinases and interacts with RIPK1, playing a crucial dual role in antiviral and inflammatory innate immune responses.(PMID: 12855817; 14519765; 28469251)

Publications

What published studies show

Anti-TLR4 (23288-1-AP) has 30 citations spanning journals including Immunity, Advanced Materials, Nucleic Acids Research, Acta Pharmaceutica Sinica B, Journal of Controlled Release, Phytomedicine, Frontiers in Immunology, International Immunopharmacology, International Journal of Molecular Sciences, Oncotarget, and Cell Signaling. Research fields cover innate immunity, inflammation, necroptosis, neuroinflammation, cancer, infectious diseases, lipid metabolism, and cardiovascular biology.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Immunity; The gut microbiota prime systemic antiviral immunity via the cGAS-STING-IFN-I axis.; Authors - Saskia F Erttmann
mouse	WB	Adv Mater; Manganese@Albumin Nanocomplex and Its Assembled Nanowire Activate TLR4-Dependent Signaling Cascades of Macrophages; Authors - Shuodan Huang
pig	WB	Nucleic Acids Res; The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response.; Authors - Xin Zong
mouse	IHC	Acta Pharm Sin B; PPARα affects hepatic lipid homeostasis by perturbing necroptosis signals in the intestinal epithelium; Authors - Shufang Na
mouse	WB	J Control Release; Nanomedicine-mediated macrophage polarization enhances the iron-depleting effect of desferrioxamine for breast cancer immunotherapy; Authors - Shiyu Chen
rat	WB,IHC,IF	Phytomedicine; Total tanshinones extract alleviates chronic prostatitis/chronic pelvic pain syndrome by modifying intestinal flora and suppressing the LPS-TLR4 axis.; Authors - Fangqing Ning