TIFA Polyclonal antibody

• 

  WB analysis using 11333-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11333-1-AP (TIFA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TIFA Polyclonal Antibody for WB, ELISA

Cat No. 11333-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

T2BP, T6BP, TIFA, TIFAA, TRAF2 binding protein

---

Tested Applications

• Positive WB detected in: K-562 cells, L02 cells, TT cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11333-1-AP targets TIFA in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1876

  Product name: Recombinant human TIFA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC014259

  Sequence: MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES

• Full Name: TRAF-interacting protein with forkhead-associated domain
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC014259
• Gene Symbol: TIFA
• Gene ID (NCBI): 92610
• RRID: AB_3669126
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIFA (TRAF-interacting protein with FHA domain-containing protein A ), also called T2BP, can interact with TRAF6 and plays an important role in innate immunity (PMID: 32910997; 35635239). Oligomerization of TIFA, which induces oligomerization and polyubiquitinylation of TRAF6, in turn activates TAK and IKK, finally mediates NF‐κB activation in the Toll‐like receptor 4/interleukin‐1 signaling pathway (PMID: 15492226; 22566686). It has been reported that TIFA also plays various roles in different cancer types (PMID: 26501855; 29263897).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Physiol Biochem; TIFA Promotes Cell Survival and Migration in Lung Adenocarcinoma.; Authors - Wanfu Men