• Featured Product
  • KD/KO Validated

TIM3 Recombinant monoclonal antibody, PBS Only

TIM3 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 82836-1-PBS
Clone No.5A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

5A8, CD366, HAVCR2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82836-1-PBS targets TIM3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2459

Product name: Recombinant human HAVCR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC020843

Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE

Predict reactive species
Full Name hepatitis A virus cellular receptor 2
Calculated Molecular Weight 301 aa, 33 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC020843
Gene Symbol TIM3
Gene ID (NCBI) 84868
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TDQ0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301).

Loading...
||
New chat

Able

正在加载,请稍候...