Tested Applications
| Positive WB detected in | MCF-7 cells, MDA-MB-231 cells |
| Positive IHC detected in | human colon cancer tissue, rat kidney tissue, rat cerebellum tissue, mouse cerebellum tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11124-2-AP targets TIM10 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1615 Product name: Recombinant human TIMM10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC032133 Sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 10 homolog (yeast) |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC032133 |
| Gene Symbol | TIMM10 |
| Gene ID (NCBI) | 26519 |
| RRID | AB_2201981 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62072 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIM10 antibody 11124-2-AP | Download protocol |
| IHC protocol for TIM10 antibody 11124-2-AP | Download protocol |
| WB protocol for TIM10 antibody 11124-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TIM10 Polyclonal antibody (Cat# 11124-2-AP) has 3 citations. These appear in Cell Stem Cell, Redox Biology, and PLoS One. The associated research fields include mitochondrial copper distribution and leukemic stem cell self-renewal, cardiac redox homeostasis and ischemia-reperfusion injury, and megakaryocytic differentiation involving respiratory chain complex IV. All three citations used the antibody for Western blot applications.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal. | ||
Redox Biol Hypoxic acclimation improves cardiac redox homeostasis and protects heart against ischemia-reperfusion injury through upregulation of O-GlcNAcylation. | ||
PLoS One Megakaryocytic Differentiation of K562 Cells Induced by PMA Reduced the Activity of Respiratory Chain Complex IV. |
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application. The reviewer reported excellent performance, noting that the antibody produces well-defined bands at a 1:1000 dilution when used with cardiac tissue and cardiomyocytes. Overall, the feedback is highly positive, highlighting clear and reliable WB results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wenhui (Verified Customer) (01-02-2025) | This antibody has been working great with WB and gives well define band.
|
